A gene on chromosome Xq24 that encodes an enzyme belonging to the family of Na+/K+ and H+/K+ ATPases, which, while found in all vertebrates, has lost its ancestral function as a Na,K-ATPase beta-subunit in placental mammals (in which it interacts with the nuclear transcriptional coregulator SKIP); it may be involved in regulating TGF-beta signalling during muscle development through its interaction with SNW1.
Segen's Medical Dictionary. © 2012 Farlex, Inc. All rights reserved.
References in periodicals archive ?
Xu et al .[sup][17] have found that 516 proteins were modified at phosphorylation level during endometriosis and the study of Zhao et al .[sup][18] indicated that ATP1B4 and FGA were associated with endometriosis pathogenesis.
We selected 4210 and 5904 m/z, which differed most between patients with EM and controls, and identified them as fragments of ATP1B4, and the fibrinogen alpha (FGA) isoform 1/2 of the FGA chain precursor, respectively.
LC-MS/MS showed the amino acid sequence of the 4210 m/z peptide as IMSEYLWDPERRMFLARTGQSWSLILLIYFFFY, a fragment of ATP1B4; and the 5904 m/z peptide sequence as SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSE ADHEGTHSTKRGHAKSRPV, which is a fragment of the fibrinogen alpha (FGA) isoform 1/2 of the FGA chain precursor.{Figure 4}{Figure 5}
LC-MS/MS sequencing showed the 4210 Da peptide to correspond uniquely to ATP1B4, and the 5904 Da protein to FGA isoform 1/2 subunit.
ATP1B4 is crucial in forming functionally active X, K-ATPases.